Recombinant Human PSMB10, His-tagged

• Cat.No.: PSMB10-31221TH
• Product Overview: Recombinant full length protein, (amino acids 40-237, excluding propeptide) of Human PSMB10 with N terminal His tag; 255 amino acids, 26.9 kDa inclusive of tag.

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.
• Protein length: 198 amino acids
• Conjugation: HIS
• Molecular Weight: 26.900kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.02% Tris HCl, 40% Glycerol, 0.58% Sodium chloride
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
• Sequence Similarities: Belongs to the peptidase T1B family.

Gene Information

• Gene Name: PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 [ Homo sapiens ]
• Official Symbol: PSMB10
• Synonyms: PSMB10; proteasome (prosome, macropain) subunit, beta type, 10; MECL1; proteasome subunit beta type-10; beta2i; LMP10; MGC1665
• Gene ID: 5699
• mRNA Refseq: NM_002801
• Protein Refseq: NP_002792
• MIM: 176847
• Uniprot ID: P40306
• Chromosome Location: 16q22.1
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; threonine-type endopeptidase activity