Recombinant Human PSMA1 protein, His-tagged

Cat.No. : PSMA1-3380H
Product Overview : Recombinant Human PSMA1 protein(P25786)(1-251aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-251aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.2 kDa
AA Sequence : MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PSMA1 proteasome (prosome, macropain) subunit, alpha type, 1 [ Homo sapiens ]
Official Symbol PSMA1
Synonyms PSMA1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome subunit alpha type-1; HC2; MGC1667; MGC14542; MGC14575; MGC14751; MGC21459; MGC22853; MGC23915; NU; PROS30; PROS-30; protein P30-33K; proteasome nu chain; macropain subunit C2; macropain subunit nu; proteasome subunit nu; 30 kDa prosomal protein; proteasome component C2; proteasome subunit, alpha-type, 1; multicatalytic endopeptidase complex subunit C2;
Gene ID 5682
mRNA Refseq NM_001143937
Protein Refseq NP_001137409
MIM 602854
UniProt ID P25786

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMA1 Products

Required fields are marked with *

My Review for All PSMA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon