Recombinant Human PRRX1

• Cat.No.: PRRX1-31000TH
• Product Overview: Recombinant full length Human PRRX1, isoform PMX1-A with N terminal proprietary tag; Predicted MWt 49.94 kDa.

Specification

• Description: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.
• Protein length: 217 amino acids
• Molecular Weight: 49.940kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLL DLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD NDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYR SSSLPRCCLHEGLHNGF
• Sequence Similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: PRRX1 paired related homeobox 1 [ Homo sapiens ]
• Official Symbol: PRRX1
• Synonyms: PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1
• Gene ID: 5396
• mRNA Refseq: NM_006902
• Protein Refseq: NP_008833
• MIM: 167420
• Uniprot ID: P54821
• Chromosome Location: 1q24.3
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity