Recombinant Human PRPSAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRPSAP2-547H
• Product Overview: PRPSAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002758) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 40.9 kDa
• AA Sequence: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRPSAP2 phosphoribosyl pyrophosphate synthetase-associated protein 2 [ Homo sapiens (human) ]
• Official Symbol: PRPSAP2
• Synonyms: PRPSAP2; phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphoribosyl pyrophosphate synthase-associated protein 2; PAP41; PRPP synthase-associated protein 2; 41 kDa phosphoribosypyrophosphate synthetase-associated protein; MGC117304; MGC126719; MGC126721
• Gene ID: 5636
• mRNA Refseq: NM_002767
• Protein Refseq: NP_002758
• MIM: 603762
• UniProt ID: O60256