Recombinant Human PROM1 Protein (508-792 aa), His-tagged

• Cat.No.: PROM1-1493H
• Product Overview: Recombinant Human PROM1 Protein (508-792 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 508-792 aa
• Description: May play a role in cell differentiation, proliferation and apoptosis . Binds cholesterol in cholesterol-containing plasma mbrane microdomains and may play a role in the organization of the apical plasma mbrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.2 kDa
• AA Sequence: GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: PROM1 prominin 1 [ Homo sapiens ]
• Official Symbol: PROM1
• Synonyms: PROM1; prominin 1; prominin-1; AC133; CD133; RP41; MCDR2; STGD4; CORD12; PROML1; MSTP061
• Gene ID: 8842
• mRNA Refseq: NM_001145847
• Protein Refseq: NP_001139319
• MIM: 604365
• UniProt ID: O43490