Recombinant Human PRMT6 Protein, GST-tagged

• Cat.No.: PRMT6-5044H
• Product Overview: Human HRMT1L6 partial ORF ( NP_060607, 241 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM
• Molecular Mass: 34.1 kDa
• AA Sequence: ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRMT6 protein arginine methyltransferase 6 [ Homo sapiens ]
• Official Symbol: PRMT6
• Synonyms: PRMT6; protein arginine methyltransferase 6; HMT1 hnRNP methyltransferase like 6 (S. cerevisiae) , HRMT1L6; protein arginine N-methyltransferase 6; FLJ10559; HMT1 hnRNP methyltransferase-like 6; histone-arginine N-methyltransferase PRMT6; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6; HRMT1L6; FLJ51477
• Gene ID: 55170
• mRNA Refseq: NM_018137
• Protein Refseq: NP_060607
• MIM: 608274
• UniProt ID: Q96LA8