Recombinant Human PRMT1 protein, T7/His-tagged

• Cat.No.: PRMT1-123H
• Product Overview: Recombinant human PRMT1 cDNA (371 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDM TSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSI SDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRAT LYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFC LQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDL DFTIDLDFKGQLCELSCSTDYRMR
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Publications:
  Arginine Methylation of the PGC-1α C-Terminus Is Temperature-Dependent (2022)

Gene Information

• Gene Name: PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ]
• Official Symbol: PRMT1
• Synonyms: PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2
• Gene ID: 3276
• mRNA Refseq: NM_001207042
• Protein Refseq: NP_001193971
• MIM: 602950
• UniProt ID: Q99873
• Chromosome Location: 19q13
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Tryptophan metabolism, organism-specific biosystem; mRNA processing, organism-specific biosystem
• Function: N-methyltransferase activity; N-methyltransferase activity; histone methyltransferase activity; histone methyltransferase activity (H4-R3 specific); methyltransferase activity; protein binding; transferase activity