Recombinant Human PRLH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRLH-6358H
• Product Overview: PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
• Molecular Mass: 9.6 kDa
• AA Sequence: MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRLH prolactin releasing hormone [ Homo sapiens (human) ]
• Official Symbol: PRLH
• Synonyms: PRLH; prolactin releasing hormone; prolactin-releasing peptide; PRH; prolactin-releasing hormone; preproprolactin-releasing peptide; PRRP
• Gene ID: 51052
• mRNA Refseq: NM_015893
• Protein Refseq: NP_056977
• MIM: 602663
• UniProt ID: P81277