Recombinant Human PRL protein(91-170 aa), C-His-tagged

• Cat.No.: PRL-2512H
• Product Overview: Recombinant Human PRL protein(P01236)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 91-170 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PRL prolactin [ Homo sapiens ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; decidual prolactin
• Gene ID: 5617
• mRNA Refseq: NM_000948
• Protein Refseq: NP_000939
• MIM: 176760
• UniProt ID: P01236