Recombinant Human PRKACA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRKACA-1917H |
Product Overview : | PRKACA MS Standard C13 and N15-labeled recombinant protein (NP_002721) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms. |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRKACA protein kinase cAMP-activated catalytic subunit alpha [ Homo sapiens (human) ] |
Official Symbol | PRKACA |
Synonyms | PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKACa; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; PKACA; MGC48865; MGC102831; |
Gene ID | 5566 |
mRNA Refseq | NM_002730 |
Protein Refseq | NP_002721 |
MIM | 601639 |
UniProt ID | P17612 |
◆ Recombinant Proteins | ||
PRKACA-7086M | Recombinant Mouse PRKACA Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKACA-1658C | Recombinant Canine PRKACA protein, His-tagged | +Inquiry |
PRKACA-2674H | Recombinant Human PRKACA protein(11-350 aa), C-His-tagged | +Inquiry |
PRKACA-2051HF | Active Recombinant Full Length Human PRKACA Protein, DDK-tagged, Biotinylated | +Inquiry |
PRKACA-31113TH | Recombinant Full Length Human PRKACA protein, Untagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKACA-1415HCL | Recombinant Human PRKACA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKACA Products
Required fields are marked with *
My Review for All PRKACA Products
Required fields are marked with *
0
Inquiry Basket