Recombinant Human PRKAA1 protein, His-tagged

• Cat.No.: PRKAA1-3871H
• Product Overview: Recombinant Human PRKAA1 protein(1-207 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-207 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: PRKAA1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Homo sapiens ]
• Official Symbol: PRKAA1
• Synonyms: PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK; alpha; 1; AMPKa1; AMPK alpha 1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP -activate kinase alpha 1 subunit; AMP-activated protein kinase, catalytic, alpha-1; 5-AMP-activated protein kinase, catalytic alpha-1 chain; MGC33776; MGC57364
• Gene ID: 5562
• mRNA Refseq: NM_006251
• Protein Refseq: NP_006242
• MIM: 602739
• UniProt ID: Q13131