Recombinant Human PRCP protein, His-tagged

• Cat.No.: PRCP-3113H
• Product Overview: Recombinant Human PRCP(Leu22-His496a) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Description: Lysosomal Pro-X Carboxypeptidase (PRCP) belongs to the peptidase S28 family. PRCP is detected in many tissues, with highest levels observed in placenta, lung, and liver. It is also present in the heart, brain, pancreas, and kidney. PRCP exists as a homodimer. PRCP cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. PRCP has been shown to be an activator of the cell matrix-associated prekallikrein.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 μm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10%Glycerol, pH4.5.
• Protein length: Leu22-His496
• AA Sequence: LRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSI LFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQAL ADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCG VFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISE TWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNI SETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMY GGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSL EVRHMKNWIRDFYDSAGKQHVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: PRCP prolylcarboxypeptidase (angiotensinase C) [ Homo sapiens ]
• Official Symbol: PRCP
• Synonyms: PRCP; prolylcarboxypeptidase (angiotensinase C); lysosomal Pro-X carboxypeptidase; HUMPCP; PCP; angiotensinase C; proline carboxypeptidase; lysosomal carboxypeptidase C; prolylcarboxypeptidase isoform 1 preproprotein; MGC2202
• Gene ID: 5547
• mRNA Refseq: NM_005040
• Protein Refseq: NP_005031
• MIM: 176785
• UniProt ID: P42785
• Chromosome Location: 11q14
• Pathway: Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Hemostasis, organism-specific biosystem; Intrinsic Pathway, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem
• Function: peptidase activity; protein binding; serine-type carboxypeptidase activity; serine-type peptidase activity