Recombinant Human PPP2R5D, GST tagged

• Cat.No.: PPP2R5D-29540TH
• Product Overview: Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 514-602 a.a.
• Description: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Weight: 35.420kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL

Gene Information

• Gene Name: PPP2R5D protein phosphatase 2, regulatory subunit B, delta [ Homo sapiens ]
• Official Symbol: PPP2R5D
• Synonyms: PPP2R5D; protein phosphatase 2, regulatory subunit B, delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform , protein phosphatase 2, regulatory subunit B, delta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
• Gene ID: 5528
• mRNA Refseq: NM_006245
• Protein Refseq: NP_006236
• MIM: 601646
• Uniprot ID: Q14738
• Chromosome Location: 6p21.1
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem
• Function: protein binding; protein phosphatase type 2A regulator activity