Recombinant Human PPP1R11 protein, GST-tagged

• Cat.No.: PPP1R11-3017H
• Product Overview: Recombinant Human PPP1R11 (1-126 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-His126
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPP1R11 protein phosphatase 1 regulatory inhibitor subunit 11 [ Homo sapiens (human) ]
• Official Symbol: PPP1R11
• Synonyms: HCGV; IPP3; HCG-V; TCTE5; TCTEX5; CFAP255
• Gene ID: 6992
• mRNA Refseq: NM_021959
• Protein Refseq: NP_068778.1
• MIM: 606670
• UniProt ID: O60927