Recombinant Human POU6F1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POU6F1-640H
• Product Overview: POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').
• Molecular Mass: 32.6 kDa
• AA Sequence: MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POU6F1 POU class 6 homeobox 1 [ Homo sapiens (human) ]
• Official Symbol: POU6F1
• Synonyms: POU6F1; POU class 6 homeobox 1; POU domain, class 6, transcription factor 1; BRN5; MPOU; TCFB1; brn-5; brain-5; mPOU homeobox protein; brain-specific homeobox/POU domain protein 5
• Gene ID: 5463
• mRNA Refseq: NM_002702
• Protein Refseq: NP_002693
• MIM: 618043
• UniProt ID: Q14863