Recombinant Human PON1, His-tagged

• Cat.No.: PON1-49H
• Product Overview: Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag.

Specification

• Description: Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
• Source: E. coli
• Species: Human
• Tag: His
• Form: Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
• AA Sequence: MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ.
• Purity: Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
• Applications: Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested.
• Storage: Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles.
• Protein length: 16-355 aa

Gene Information

• Gene Name: PON1 paraoxonase 1 [ Homo sapiens ]
• Official Symbol: PON1
• Synonyms: ESA; PON; MVCD5; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1
• Gene ID: 5444
• mRNA Refseq: NM_000446
• Protein Refseq: NP_000437
• MIM: 168820
• UniProt ID: P27169
• Chromosome Location: 7q21.3
• Pathway: Metabolic pathways, organism-specific biosystem; Phase I, non P450, organism-specific biosystem
• Function: aryldialkylphosphatase activity; arylesterase activity; calcium ion binding