Recombinant Human POLR3K protein, His-SUMO-tagged

• Cat.No.: POLR3K-3355H
• Product Overview: Recombinant Human POLR3K protein(Q9Y2Y1)(1-108aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-108aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.3 kDa
• AA Sequence: MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: POLR3K polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [ Homo sapiens ]
• Official Symbol: POLR3K
• Synonyms: POLR3K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); DNA-directed RNA polymerase III subunit RPC10; RPC11; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerases III 12.5 kDa polypeptide; C11; My010; RPC10; hRPC11; RPC12.5; C11-RNP3
• Gene ID: 51728
• mRNA Refseq: NM_016310
• Protein Refseq: NP_057394
• MIM: 606007
• UniProt ID: Q9Y2Y1