Recombinant Human POLR3H Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR3H-5994H
• Product Overview: POLR3H MS Standard C13 and N15-labeled recombinant protein (NP_001018060) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
• Molecular Mass: 22.9 kDa
• AA Sequence: MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR3H RNA polymerase III subunit H [ Homo sapiens (human) ]
• Official Symbol: POLR3H
• Synonyms: POLR3H; polymerase (RNA) III (DNA directed) polypeptide H (22.9kD); DNA-directed RNA polymerase III subunit RPC8; KIAA1665; RPC8; RNA polymerase III subunit C8; RNA polymerase III subunit RPC8; DNA-directed RNA polymerase III subunit H; RNA nucleotidyltransferase (DNA-directed); RNA polymerase III subunit 22.9 kDa subunit; DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide; RPC22.9; MGC29654; MGC111097
• Gene ID: 171568
• mRNA Refseq: NM_001018050
• Protein Refseq: NP_001018060
• UniProt ID: Q9Y535