Recombinant Human POLE3 protein, GST-tagged

• Cat.No.: POLE3-1220H
• Product Overview: Recombinant Human POLE3 protein(1-147 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-147 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: POLE3 polymerase (DNA directed), epsilon 3 (p17 subunit) [ Homo sapiens ]
• Official Symbol: POLE3
• Synonyms: POLE3; polymerase (DNA directed), epsilon 3 (p17 subunit); DNA polymerase epsilon subunit 3; arsenic transactivated protein; CHARAC17; CHRAC17; chromatin accessibility complex 17; DNA polymerase epsilon p17 subunit; histone fold protein CHRAC17; p17; Ybl1; asTP; CHRAC-17; huCHRAC17; DNA polymerase II subunit 3; arsenic-transactivated protein; DNA polymerase epsilon subunit p17; chromatin accessibility complex 17 kDa protein; YBL1
• Gene ID: 54107
• mRNA Refseq: NM_017443
• Protein Refseq: NP_059139
• MIM: 607267
• UniProt ID: Q9NRF9