Recombinant Human PNP protein(11-280 aa), C-His-tagged
Cat.No. : | PNP-2498H |
Product Overview : | Recombinant Human PNP protein(P00491)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKA |
Gene Name | PNP purine nucleoside phosphorylase [ Homo sapiens ] |
Official Symbol | PNP |
Synonyms | PNP; purine nucleoside phosphorylase; NP, nucleoside phosphorylase; PUNP; inosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; NP; PRO1837; FLJ94043; FLJ97288; FLJ97312; MGC117396; MGC125915; MGC125916; |
Gene ID | 4860 |
mRNA Refseq | NM_000270 |
Protein Refseq | NP_000261 |
MIM | 164050 |
UniProt ID | P00491 |
◆ Recombinant Proteins | ||
PNP-4724H | Recombinant Human PNP Protein (Met1-Ser289), N-His tagged | +Inquiry |
PNP-832H | Recombinant Human PNP Protein, GST-tagged | +Inquiry |
Pnp-2425R | Recombinant Rat Pnp protein, His-tagged | +Inquiry |
PNP-1101H | Active Recombinant Human PNP Protein, His-tagged | +Inquiry |
PNP-3494R | Recombinant Rhesus monkey PNP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNP Products
Required fields are marked with *
My Review for All PNP Products
Required fields are marked with *
0
Inquiry Basket