Recombinant Human PNP protein(11-280 aa), C-His-tagged

Cat.No. : PNP-2498H
Product Overview : Recombinant Human PNP protein(P00491)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-280 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKA
Gene Name PNP purine nucleoside phosphorylase [ Homo sapiens ]
Official Symbol PNP
Synonyms PNP; purine nucleoside phosphorylase; NP, nucleoside phosphorylase; PUNP; inosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; NP; PRO1837; FLJ94043; FLJ97288; FLJ97312; MGC117396; MGC125915; MGC125916;
Gene ID 4860
mRNA Refseq NM_000270
Protein Refseq NP_000261
MIM 164050
UniProt ID P00491

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PNP Products

Required fields are marked with *

My Review for All PNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon