Recombinant Human PMP22 Protein, His-tagged

• Cat.No.: PMP22-1811H
• Product Overview: Recombinant Human PMP22 Protein(31-133 aa), fused with His Tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 31-133 aa
• AA Sequence: GNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYG
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PMP22 peripheral myelin protein 22 [ Homo sapiens ]
• Official Symbol: PMP22
• Synonyms: PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110; PMP-22; growth arrest-specific 3; growth arrest-specific protein 3; DSS; CMT1A; CMT1E; GAS-3; HMSNIA; MGC20769
• Gene ID: 5376
• mRNA Refseq: NM_000304
• Protein Refseq: NP_000295
• MIM: 601097
• UniProt ID: Q01453