Recombinant Human PMP22 Protein, His-tagged
Cat.No. : | PMP22-1811H |
Product Overview : | Recombinant Human PMP22 Protein(31-133 aa), fused with His Tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-133 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PMP22 peripheral myelin protein 22 [ Homo sapiens ] |
Official Symbol | PMP22 |
Synonyms | PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110; PMP-22; growth arrest-specific 3; growth arrest-specific protein 3; DSS; CMT1A; CMT1E; GAS-3; HMSNIA; MGC20769; |
Gene ID | 5376 |
mRNA Refseq | NM_000304 |
Protein Refseq | NP_000295 |
MIM | 601097 |
UniProt ID | Q01453 |
◆ Recombinant Proteins | ||
PMP22-4542R | Recombinant Rat PMP22 Protein | +Inquiry |
RFL2736EF | Recombinant Full Length Horse Peripheral Myelin Protein 22(Pmp22) Protein, His-Tagged | +Inquiry |
PMP22-1812H | Recombinant Human PMP22 Protein, His-SUMO-tagged | +Inquiry |
PMP22-4473H | Recombinant Human PMP22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PMP22-30913TH | Recombinant Human PMP22 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMP22 Products
Required fields are marked with *
My Review for All PMP22 Products
Required fields are marked with *
0
Inquiry Basket