Recombinant Human PLXNB1 protein, His-tagged
Cat.No. : | PLXNB1-4479H |
Product Overview : | Recombinant Human PLXNB1 protein(O43157)(20-535aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-535aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.4 kDa |
AA Sequence : | LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PLXNB1 plexin B1 [ Homo sapiens ] |
Official Symbol | PLXNB1 |
Synonyms | PLXNB1; plexin B1; PLXN5; plexin-B1; KIAA0407; SEP; plexin 5; semaphorin receptor SEP; PLEXIN-B1; MGC149167; |
Gene ID | 5364 |
mRNA Refseq | NM_001130082 |
Protein Refseq | NP_001123554 |
MIM | 601053 |
UniProt ID | O43157 |
◆ Recombinant Proteins | ||
PLXNB1-4605C | Recombinant Chicken PLXNB1 | +Inquiry |
PLXNB1-7544H | Recombinant Human PLXNB1 protein, His&Myc-tagged | +Inquiry |
PLXNB1-4827H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
PLXNB1-4940H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
Plxnb1-744M | Recombinant Mouse Plxnb1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLXNB1 Products
Required fields are marked with *
My Review for All PLXNB1 Products
Required fields are marked with *
0
Inquiry Basket