Recombinant Human PLEKHD1 Protein, GST-tagged

• Cat.No.: PLEKHD1-4346H
• Product Overview: Human FLJ44817 full-length ORF (1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: PLEKHD1 (Pleckstrin Homology And Coiled-Coil Domain Containing D1) is a Protein Coding gene. Diseases associated with PLEKHD1 include Atrial Heart Septal Defect.
• Molecular Mass: 39.3 kDa
• AA Sequence: MFTSKSNSVSPSPSLEQADSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLLYYSESEKKSFETNKYFNIHPKVRRPLPGPQQGRAQCGHQSLHLVRGGDCALALA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLEKHD1 pleckstrin homology and coiled-coil domain containing D1 [ Homo sapiens (human) ]
• Official Symbol: PLEKHD1
• Synonyms: PLEKHD1; pleckstrin homology and coiled-coil domain containing D1; UPF0639; pleckstrin homology domain-containing family D member 1; PH domain-containing family D member 1; UPF0639 protein; pleckstrin homology domain containing, family D (with M protein repeats) member 1; pleckstrin homology domain containing, family D (with coiled-coil domains) member 1; Pleckstrin Homology And Coiled-Coil Domain Containing D1; Pleckstrin Homology Domain Containing, Family D (With Coiled-Coil Domains) Member 1; Pleckstrin Homology Domain Containing, Family D (With M Protein Repeats) Member 1; PH Domain-Containing Family D Member 1; Pleckstrin Homology Domain-Containing Family D Member 1; UPF0639 Protein
• Gene ID: 400224
• mRNA Refseq: NM_001161498
• Protein Refseq: NP_001154970
• UniProt ID: A6NEE1