Recombinant Human PLBD2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | PLBD2-084H |
Product Overview : | PLBD2 MS Standard C13 and N15-labeled recombinant protein (NP_775813) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PLBD2 (Phospholipase B Domain Containing 2) is a Protein Coding gene. Diseases associated with PLBD2 include Gallbladder Papillomatosis and Gm1-Gangliosidosis, Type Iii. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is PLBD1. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PLBD2 phospholipase B domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | PLBD2 |
Synonyms | PLBD2; phospholipase B domain containing 2; P76; putative phospholipase B-like 2; 76 kDa protein; LAMA-like protein 2; PLB homolog 2; lamina ancestor homolog 2; mannose-6-phosphate protein associated protein p76; phospholipase B domain-containing protein 2; phospholipase B-like 2 32 kDa form; phospholipase B-like 2 45 kDa form; EC 3.1.1.- |
Gene ID | 196463 |
mRNA Refseq | NM_173542 |
Protein Refseq | NP_775813 |
UniProt ID | Q8NHP8 |
◆ Recombinant Proteins | ||
Plbd2-5101M | Recombinant Mouse Plbd2 protein, His-tagged | +Inquiry |
PLBD2-1740R | Recombinant Rat PLBD2 Protein (36-585 aa), His-tagged | +Inquiry |
Plbd2-016H | Recombinant Hamster phospholipase B domain containing 2 Protein, His tagged | +Inquiry |
PLBD2-3371C | Recombinant Chinese hamster PLBD2 protein(Leu38-Asp585), His-tagged | +Inquiry |
PLBD2-2164M | Recombinant Mouse PLBD2 Protein (47-594 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLBD2 Products
Required fields are marked with *
My Review for All PLBD2 Products
Required fields are marked with *
0
Inquiry Basket