Recombinant Human PLBD2 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: PLBD2-084H
• Product Overview: PLBD2 MS Standard C13 and N15-labeled recombinant protein (NP_775813) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PLBD2 (Phospholipase B Domain Containing 2) is a Protein Coding gene. Diseases associated with PLBD2 include Gallbladder Papillomatosis and Gm1-Gangliosidosis, Type Iii. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is PLBD1.
• Molecular Mass: 65.5 kDa
• AA Sequence: MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PLBD2 phospholipase B domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: PLBD2
• Synonyms: PLBD2; phospholipase B domain containing 2; P76; putative phospholipase B-like 2; 76 kDa protein; LAMA-like protein 2; PLB homolog 2; lamina ancestor homolog 2; mannose-6-phosphate protein associated protein p76; phospholipase B domain-containing protein 2; phospholipase B-like 2 32 kDa form; phospholipase B-like 2 45 kDa form; EC 3.1.1.-
• Gene ID: 196463
• mRNA Refseq: NM_173542
• Protein Refseq: NP_775813
• UniProt ID: Q8NHP8