Recombinant Human PLAUR Protein, His-tagged
Cat.No. : | PLAUR-472H |
Product Overview : | Recombinant human PLAUR protein with His tag was expressed in HEK293. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 335 |
Description : | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. |
Form : | Lyophilized |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | PLAUR plasminogen activator, urokinase receptor [ Homo sapiens (human) ] |
Official Symbol | PLAUR |
Synonyms | PLAUR; plasminogen activator, urokinase receptor; urokinase plasminogen activator surface receptor; CD87; UPAR; URKR; urokinase type plasminogen activator (uPA) receptor; monocyte activation antigen Mo3; u-plasminogen activator receptor form 2; urokinase-type plasminogen activator (uPA) receptor; U-PAR; |
Gene ID | 5329 |
mRNA Refseq | NM_001005376 |
Protein Refseq | NP_001005376 |
MIM | 173391 |
UniProt ID | Q03405 |
◆ Recombinant Proteins | ||
Plaur-4909M | Recombinant Mouse Plaur Protein, Myc/DDK-tagged | +Inquiry |
PLAUR-1573H | Recombinant Human PLAUR protein, His-Avi-tagged, Biotinylated | +Inquiry |
PLAUR-923H | Recombinant Human PLAUR Protein, His-tagged | +Inquiry |
PLAUR-1569H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
PLAUR-4657H | Active Recombinant Human PLAUR Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *
0
Inquiry Basket