Recombinant Human PLAUR Protein (23-305 aa), GST-tagged

• Cat.No.: PLAUR-725H
• Product Overview: Recombinant Human PLAUR Protein (23-305 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 23-305 aa
• Description: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 58.5 kDa
• AA Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: PLAUR plasminogen activator, urokinase receptor [ Homo sapiens ]
• Official Symbol: PLAUR
• Synonyms: PLAUR; CD87; UPAR; URKR; U-PAR
• Gene ID: 5329
• mRNA Refseq: NM_001005376
• Protein Refseq: NP_001005376
• MIM: 173391
• UniProt ID: Q03405