Recombinant Human PLAA protein, GST-tagged
Cat.No. : | PLAA-13H |
Product Overview : | Recombinant Human PLAA(639 a.a. - 738 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 639-738 a.a. |
Description : | PLAA played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PLAA phospholipase A2-activating protein [ Homo sapiens ] |
Official Symbol | PLAA |
Synonyms | PLAA; phospholipase A2-activating protein; phospholipase A-2-activating protein; DOA1; DOA1 homolog (S. cerevisiae); FLJ11281; FLJ12699; PLA2P; PLAP; DOA1 homolog; phospholipase A2 activating protein; |
Gene ID | 9373 |
mRNA Refseq | NM_001031689 |
Protein Refseq | NP_001026859 |
MIM | 603873 |
UniProt ID | Q9Y263 |
Chromosome Location | 9p21 |
Pathway | Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function | phospholipase A2 activator activity; |
◆ Recombinant Proteins | ||
PLAA-12904M | Recombinant Mouse PLAA Protein | +Inquiry |
PLAA-2695M | Recombinant Mouse PLAA Protein (495-584 aa), His-Myc-tagged | +Inquiry |
PLAA-12H | Recombinant Human PLAA protein, GST-tagged | +Inquiry |
PLAA-2597H | Recombinant Human PLAA protein, His-tagged | +Inquiry |
PLAA-45HCL | Recombinant Human PLAA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLAA Products
Required fields are marked with *
My Review for All PLAA Products
Required fields are marked with *
0
Inquiry Basket