Recombinant Human PLAA protein, GST-tagged

Cat.No. : PLAA-13H
Product Overview : Recombinant Human PLAA(639 a.a. - 738 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 639-738 a.a.
Description : PLAA played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PLAA phospholipase A2-activating protein [ Homo sapiens ]
Official Symbol PLAA
Synonyms PLAA; phospholipase A2-activating protein; phospholipase A-2-activating protein; DOA1; DOA1 homolog (S. cerevisiae); FLJ11281; FLJ12699; PLA2P; PLAP; DOA1 homolog; phospholipase A2 activating protein;
Gene ID 9373
mRNA Refseq NM_001031689
Protein Refseq NP_001026859
MIM 603873
UniProt ID Q9Y263
Chromosome Location 9p21
Pathway Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;
Function phospholipase A2 activator activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLAA Products

Required fields are marked with *

My Review for All PLAA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon