Recombinant Human PLA2G2D Protein

Description :	This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms.
Source :	E. coli
Species :	Human
Form :	20 mM Tris-HCl, 100mM NaCl, PH8.0
Molecular Mass :	~16.5 kDa
AA sequence :	MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCC QTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLD TYQKRLRFYWRPHCRGQTPGC
Endotoxin :	< 1.0 EU per μg of the protein as determined by the LAL method
Purity :	>95% by SDS-PAGE
Tag :	Non

Gene Name	PLA2G2D phospholipase A2, group IID [ Homo sapiens ]
Official Symbol	PLA2G2D
Synonyms	PLA2G2D; phospholipase A2, group IID; group IID secretory phospholipase A2; sPLA2S; PLA2IID; sPLA2-IID; GIID sPLA2; secretory phospholipase A2s; phosphatidylcholine 2-acylhydrolase 2D; secretory-type PLA, stroma-associated homolog; SPLASH;
Gene ID	26279
mRNA Refseq	NM_012400
Protein Refseq	NP_036532
MIM	605630
UniProt ID	Q9UNK4