Recombinant Human PHYKPL Protein, GST-tagged

• Cat.No.: PHYKPL-4351H
• Product Overview: Human MGC15875 full-length ORF ( ENSP00000321290, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
• Molecular Mass: 45.3 kDa
• AA Sequence: MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PHYKPL 5-phosphohydroxy-L-lysine phospho-lyase [ Homo sapiens (human) ]
• Official Symbol: PHYKPL
• Synonyms: PHYKPL; 5-phosphohydroxy-L-lysine phospho-lyase; PHLU; AGXT2L2
• Gene ID: 85007
• mRNA Refseq: NM_153373
• Protein Refseq: NP_699204
• MIM: 614683
• UniProt ID: Q8IUZ5