Recombinant Human PHBP19 Protein, GST-tagged

Cat.No. : PHBP19-4777H
Product Overview : Human LOC494150 full-length ORF ( AAH14228.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : PHBP19 (Prohibitin Pseudogene 19) is a Pseudogene.
Molecular Mass : 48.5 kDa
AA Sequence : MGTETNYLCLSPPRNVPIITGSKDLQNVNITLRIIFQPVASQLPRIFTSIGEDYDEPVLTYITTEILKSVVARFDAGEVITQRELVSRQVSNDLTEQAATFGLILDDVSLTYLTFGKEFTEAVEAKQVAQQEAERARFVKEKAEQQKKAEQQKKVEQQKKAAVISAEGDSKATELIVNSLATAGDGLMELCKLEAAEALGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PHBP19 prohibitin pseudogene 19 [ Homo sapiens (human) ]
Official Symbol PHBP19
Synonyms PHBP19; prohibitin pseudogene 19;
Gene ID 494150

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PHBP19 Products

Required fields are marked with *

My Review for All PHBP19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon