Recombinant Human PFDN2, His-tagged

• Cat.No.: PFDN2-28101TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-154 of Human PFDN2 with N terminal His tag, 20kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-154 a.a.
• Description: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 100 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGL ASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVL VERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
• Full Length: Full L.

Gene Information

• Gene Name: PFDN2 prefoldin subunit 2 [ Homo sapiens ]
• Official Symbol: PFDN2
• Synonyms: PFDN2; prefoldin subunit 2; prefoldin 2
• Gene ID: 5202
• mRNA Refseq: NM_012394
• Protein Refseq: NP_036526
• MIM: 613466
• Uniprot ID: Q9UHV9
• Chromosome Location: 1q23.3
• Pathway: Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: unfolded protein binding