Recombinant Human PEX3 protein, GST-tagged
Cat.No. : | PEX3-11H |
Product Overview : | Human PEX3 partial ORF (NP_003621, 271a.a.-373a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 103 |
Description : | The product of this gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.07 kDa |
AA Sequence : | LESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PEX3 |
Official Symbol | PEX3 |
Synonyms | DKFZp686N14184,FLJ13531,TRG18 |
Gene ID | 8504 |
mRNA Refseq | NM_003630.3 |
Protein Refseq | NP_003621.1 |
MIM | 603164 |
UniProt ID | P56589 |
◆ Cell & Tissue Lysates | ||
PEX3-3286HCL | Recombinant Human PEX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX3 Products
Required fields are marked with *
My Review for All PEX3 Products
Required fields are marked with *
0
Inquiry Basket