Recombinant Human PEX19, His-tagged
Cat.No. : | PEX19-27601TH |
Product Overview : | Recombinant full length Human PEX19 with an N terminal His tag; 316aa, 34.6kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 296 amino acids |
Description : | This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 34.600kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.32% Tris HCl |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC |
Sequence Similarities : | Belongs to the peroxin-19 family. |
Gene Name | PEX19 peroxisomal biogenesis factor 19 [ Homo sapiens ] |
Official Symbol | PEX19 |
Synonyms | PEX19; peroxisomal biogenesis factor 19; peroxisomal farnesylated protein , PXF; D1S2223E; HK33; housekeeping gene; 33kD; PMP1; PMPI; PXMP1; |
Gene ID | 5824 |
mRNA Refseq | NM_001193644 |
Protein Refseq | NP_001180573 |
Uniprot ID | P40855 |
Chromosome Location | 1q22 |
Pathway | ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | protein N-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
PEX19-12650M | Recombinant Mouse PEX19 Protein | +Inquiry |
PEX19-6647M | Recombinant Mouse PEX19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX19-2318Z | Recombinant Zebrafish PEX19 | +Inquiry |
PEX19-28143TH | Recombinant Human PEX19, His-tagged | +Inquiry |
PEX19-2962H | Recombinant Human PEX19, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX19-3289HCL | Recombinant Human PEX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX19 Products
Required fields are marked with *
My Review for All PEX19 Products
Required fields are marked with *
0
Inquiry Basket