Recombinant Human PDPK1 protein, GST-tagged
Cat.No. : | PDPK1-1866H |
Product Overview : | Recombinant Human PDPK1 protein(198-556 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 198-556 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDPK1 3-phosphoinositide dependent protein kinase-1 [ Homo sapiens ] |
Official Symbol | PDPK1 |
Synonyms | PDPK1; 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; PDK1; PkB kinase; PkB-like 1; PkB kinase like gene 1; PRO0461; MGC20087; MGC35290; |
Gene ID | 5170 |
mRNA Refseq | NM_002613 |
Protein Refseq | NP_002604 |
MIM | 605213 |
UniProt ID | O15530 |
◆ Recombinant Proteins | ||
PDPK1-4825H | Recombinant Human PDPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDPK1-448H | Recombinant Human PDPK1 Protein, His-tagged | +Inquiry |
Pdpk1-4777M | Recombinant Mouse Pdpk1 Protein, Myc/DDK-tagged | +Inquiry |
PDPK1-1077H | Recombinant Human PDPK1 Protein (M51-A360), His tagged | +Inquiry |
PDPK1-4357R | Recombinant Rat PDPK1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDPK1-3322HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry |
PDPK1-3321HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDPK1 Products
Required fields are marked with *
My Review for All PDPK1 Products
Required fields are marked with *
0
Inquiry Basket