Recombinant Human PDLIM2, His-tagged

• Cat.No.: PDLIM2-29566TH
• Product Overview: Recombinant fragment, corresponding to amino acids 188-352 of Human PDLIM2 with N terminal His tag; 165 amino acids, 22kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 188-352 a.a.
• Description: This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 126 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQ ENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSL SPQSSLPASRALATPPKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYS APATLSSRA
• Sequence Similarities: Contains 1 LIM zinc-binding domain.Contains 1 PDZ (DHR) domain.

Gene Information

• Gene Name: PDLIM2 PDZ and LIM domain 2 (mystique) [ Homo sapiens ]
• Official Symbol: PDLIM2
• Synonyms: PDLIM2; PDZ and LIM domain 2 (mystique); PDZ and LIM domain protein 2
• Gene ID: 64236
• mRNA Refseq: NM_021630
• Protein Refseq: NP_067643
• MIM: 609722
• Uniprot ID: Q96JY6
• Chromosome Location: 8p21.3
• Function: metal ion binding; zinc ion binding