Recombinant Human PDGFRB Protein (33-532aa), C-hIgG-His tagged
Cat.No. : | PDGFRB-129H |
Product Overview : | Recombinant human PDGFRB (33-532aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 33-532aa |
Description : | This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia. |
Form : | Liquid |
Molecular Mass : | 83.3 kDa (739aa) |
AA Sequence : | LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKV< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH> |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | PDGFRB platelet-derived growth factor receptor, beta polypeptide [ Homo sapiens (human) ] |
Official Symbol | PDGFRB |
Synonyms | PDGFRB; platelet-derived growth factor receptor, beta polypeptide; PDGFR; platelet-derived growth factor receptor beta; CD140b; JTK12; PDGFR1; PDGFR-beta; PDGF-R-beta; CD140 antigen-like family member B; platelet-derived growth factor receptor 1; beta-type platelet-derived growth factor receptor; CD140B; PDGFR-1; |
Gene ID | 5159 |
mRNA Refseq | NM_002609 |
Protein Refseq | NP_002600 |
MIM | 173410 |
UniProt ID | P09619 |
◆ Recombinant Proteins | ||
PDGFRB-2187HAF488 | Recombinant Human PDGFRB Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Pdgfrb-8786RAF488 | Recombinant Rat Pdgfrb Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Pdgfrb-306R | Active Recombinant Rat Pdgfrb Protein, hFc-tagged | +Inquiry |
PDGFRB-129H | Recombinant Human PDGFRB Protein (33-532aa), C-hIgG-His tagged | +Inquiry |
PDGFRB-1207R | Active Recombinant Rhesus PDGFRB protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRB-1112RCL | Recombinant Rat PDGFRB cell lysate | +Inquiry |
PDGFRB-1046CCL | Recombinant Cynomolgus PDGFRB cell lysate | +Inquiry |
PDGFRB-1107HCL | Recombinant Human PDGFRB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDGFRB Products
Required fields are marked with *
My Review for All PDGFRB Products
Required fields are marked with *
0
Inquiry Basket