Recombinant Human PDE6H Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PDE6H-5259H
Product Overview : PDE6H MS Standard C13 and N15-labeled recombinant protein (NP_006196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is involved in the transmission and amplification of the visual signal. Mutations in this gene are associated with retinal cone dystrophy type 3A (RCD3A).
Molecular Mass : 9.1 kDa
AA Sequence : MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PDE6H phosphodiesterase 6H [ Homo sapiens (human) ]
Official Symbol PDE6H
Synonyms PDE6H; RCD3; ACHM6; phosphodiesterase 6H, cGMP-specific, cone, gamma; retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; GMP-PDE gamma; EC 3.1.4.35
Gene ID 5149
mRNA Refseq NM_006205
Protein Refseq NP_006196
MIM 601190
UniProt ID Q13956

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDE6H Products

Required fields are marked with *

My Review for All PDE6H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon