Recombinant Human PDCD1 protein, His-tagged
Cat.No. : | PDCD1-472H |
Product Overview : | Recombinant Human PDCD1(1 - 288 aa) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 288 aa |
Description : | This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
Molecular Mass : | 38 kDa |
AA Sequence : | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQ TDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGE LDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL |
Purity : | > 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | PDCD1 programmed cell death 1 [ Homo sapiens ] |
Official Symbol | PDCD1 |
Synonyms | PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; protein PD-1; PD-1; SLEB2; hPD-1; hPD-l; |
Gene ID | 5133 |
mRNA Refseq | NM_005018 |
Protein Refseq | NP_005009 |
MIM | 600244 |
UniProt ID | Q15116 |
Chromosome Location | 2q37.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem; T cell receptor signaling pathway, organism-specific biosystem; |
Function | protein binding; protein tyrosine phosphatase activity; signal transducer activity; |
◆ Recombinant Proteins | ||
PDCD1-188HA | Recombinant Human PDCD1 protein, Fc-tagged, APC labeled | +Inquiry |
PDCD1-1222RF | Active Recombinant Monkey PDCD1 Protein, His-tagged, FITC conjugated | +Inquiry |
Pdcd1-823MF | Recombinant Mouse Pdcd1 Protein, His-tagged, FITC conjugated | +Inquiry |
PDCD1-189HAF647 | Active Recombinant Human PDCD1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
PDCD1-173H | Active Recombinant Human PDCD1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1-001RCL | Recombinant Rat PDCD1 cell lysate | +Inquiry |
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
PDCD1-2628MCL | Recombinant Mouse PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD1 Products
Required fields are marked with *
My Review for All PDCD1 Products
Required fields are marked with *
0
Inquiry Basket