Recombinant Human PDCD1

Cat.No. : PDCD1-29487TH
Product Overview : Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
Sequence Similarities : Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name PDCD1 programmed cell death 1 [ Homo sapiens ]
Official Symbol PDCD1
Synonyms PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1;
Gene ID 5133
mRNA Refseq NM_005018
Protein Refseq NP_005009
MIM 600244
Uniprot ID Q15116
Chromosome Location 2q37.3
Pathway Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function protein binding; protein tyrosine phosphatase activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDCD1 Products

Required fields are marked with *

My Review for All PDCD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon