Recombinant Human PCHRM2 protein, GST-tagged

• Cat.No.: CHRM2-301527H
• Product Overview: Recombinant Human CHRM2 (210-373 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser210-Ala373
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CHRM2 cholinergic receptor, muscarinic 2 [ Homo sapiens ]
• Official Symbol: CHRM2
• Synonyms: CHRM2; cholinergic receptor, muscarinic 2; muscarinic acetylcholine receptor M2; acetylcholine receptor; muscarinic 2; 7TM receptor; muscarinic M2 receptor; acetylcholine receptor, muscarinic 2; cholinergic receptor, muscarinic 2, isoform a; HM2; FLJ43243; MGC120006; MGC120007
• Gene ID: 1129
• mRNA Refseq: NM_000739
• Protein Refseq: NP_000730
• MIM: 118493
• UniProt ID: P08172