Tag :	N-His
ProteinLength :	189-386 aa
Tag :	N-His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	GILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	PAX2 paired box 2 [ Homo sapiens ]
Official Symbol	PAX2
Synonyms	PAX2; paired box 2; paired box gene 2; paired box protein Pax-2; paired box homeotic gene 2;
Gene ID	5076
mRNA Refseq	NM_000278
Protein Refseq	NP_000269
MIM	167409
UniProt ID	Q02962

COA

Cat.No. :	PAX2-1753H
Product Overview :	Recombinant Human PAX2 protein(189-386 aa), fused with N-terminal His tag, was expressed in E. coli.

Recombinant Human PAX2 protein, His-tagged