Recombinant Human PAX2 protein, GST-tagged

Cat.No. : PAX2-1750H
Product Overview : Recombinant Human PAX2 protein(180-229 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Tag : N-GST
ProteinLength : 180-229 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : DPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name PAX2 paired box 2 [ Homo sapiens ]
Official Symbol PAX2
Synonyms PAX2; paired box 2; paired box gene 2; paired box protein Pax-2; paired box homeotic gene 2;
Gene ID 5076
mRNA Refseq NM_000278
Protein Refseq NP_000269
MIM 167409
UniProt ID Q02962

Not For Human Consumption!

Inquiry

0

Inquiry Basket

cartIcon