Recombinant Human PARP9 protein, His-tagged

• Cat.No.: PARP9-4458H
• Product Overview: Recombinant Human PARP9 protein(Q8IXQ6)(628-854aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.0 kDa
• Protein length: 628-854aa
• AA Sequence: IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PARP9 poly (ADP-ribose) polymerase family, member 9 [ Homo sapiens ]
• Official Symbol: PARP9
• Synonyms: PARP9; poly (ADP-ribose) polymerase family, member 9; poly [ADP-ribose] polymerase 9; BAL; BAL1; PARP-9; b aggressive lymphoma protein; poly (ADP-ribose) polymerase 9; MGC:7868; FLJ26637; FLJ35310; FLJ41418; FLJ43593; DKFZp666B0810; DKFZp686M15238
• Gene ID: 83666
• mRNA Refseq: NM_001146102
• Protein Refseq: NP_001139574
• MIM: 612065
• UniProt ID: Q8IXQ6