Recombinant Human PARP9 protein, His-tagged
Cat.No. : | PARP9-4458H |
Product Overview : | Recombinant Human PARP9 protein(Q8IXQ6)(628-854aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 628-854aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.0 kDa |
AA Sequence : | IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PARP9 poly (ADP-ribose) polymerase family, member 9 [ Homo sapiens ] |
Official Symbol | PARP9 |
Synonyms | PARP9; poly (ADP-ribose) polymerase family, member 9; poly [ADP-ribose] polymerase 9; BAL; BAL1; PARP-9; b aggressive lymphoma protein; poly (ADP-ribose) polymerase 9; MGC:7868; FLJ26637; FLJ35310; FLJ41418; FLJ43593; DKFZp666B0810; DKFZp686M15238; |
Gene ID | 83666 |
mRNA Refseq | NM_001146102 |
Protein Refseq | NP_001139574 |
MIM | 612065 |
UniProt ID | Q8IXQ6 |
◆ Recombinant Proteins | ||
PARP9-437H | Recombinant Human PARP9, GST-tagged | +Inquiry |
PARP9-4458H | Recombinant Human PARP9 protein, His-tagged | +Inquiry |
PARP9-1535H | Recombinant Human PARP9, GST-tagged | +Inquiry |
PARP9-5932H | Recombinant Human PARP9 protein, His&Myc-tagged | +Inquiry |
PARP9-29529TH | Recombinant Human PARP9 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PARP9 Products
Required fields are marked with *
My Review for All PARP9 Products
Required fields are marked with *
0
Inquiry Basket