Recombinant Human PARK2

Cat.No. : PARK2-30784TH
Product Overview : Recombinant full length Human Parkin with N terminal proprietary tag; Predicted MWt 68.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 387 amino acids
Description : The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.
Molecular Weight : 68.640kDa inclusive of tags
Tissue specificity : Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons fro
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQ LRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQ EMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVG LAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQR VQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGEC QSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSR NITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLND RQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGC PNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCP RPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Sequence Similarities : Belongs to the RBR family. Parkin subfamily.Contains 1 IBR-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.
Gene Name PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ]
Official Symbol PARK2
Synonyms PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ;
Gene ID 5071
mRNA Refseq NM_004562
Protein Refseq NP_004553
MIM 602544
Uniprot ID O60260
Chromosome Location 6q25.2-q27
Pathway Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing &
Function PDZ domain binding; acid-amino acid ligase activity; chaperone binding; kinase binding; ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PARK2 Products

Required fields are marked with *

My Review for All PARK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon