Recombinant Human papillomavirus type 18 L1 Protein, His-tagged
Cat.No. : | L1-43H |
Product Overview : | Recombinant Human papillomavirus type 18 L1 Protein, fused to His-tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human papillomavirus type 18 |
Source : | E.coli |
Tag : | His |
Protein Length : | 51-568 a.a. |
Description : | major capsid L1 protein |
Form : | PBS, 0.05%SKL, pH7.4. |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MRNVNVFPIFLQMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKRVRVRARKHHHHHHHH |
Endotoxin : | <1EU/ug |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.4 mg/ml |
Gene Name | L1 major capsid L1 protein [ Alphapapillomavirus 7 ] |
Official Symbol | L1 |
Synonyms | HpV18gp8 |
Gene ID | 1489090 |
Protein Refseq | NP_040317 |
UniProt ID | P06794 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L1 Products
Required fields are marked with *
My Review for All L1 Products
Required fields are marked with *
0
Inquiry Basket