Recombinant Human papillomavirus 45 L1 Protein, His-tagged

• Cat.No.: L1-46H
• Product Overview: Human papillomavirus 45 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human papillomavirus 45
• Source: E.coli
• Tag: His
• Description: major capsid L1 protein
• Form: PBS, pH7.4.
• Molecular Mass: 58 kDa
• AA Sequence: MRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGHNNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKKHHHHHHHH
• Endotoxin: ＜1EU/ug
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.14 mg/ml

Gene Information

• Gene Name: L1 major capsid protein L1 [ Human papillomavirus type 48 ]
• Official Symbol: L1
• Gene ID: 1403627
• Protein Refseq: NP_043422
• UniProt ID: P36741