Recombinant Human papillomavirus 31 L1 Protein, His-tagged

• Cat.No.: L1-44H
• Product Overview: Recombinant Human papillomavirus 31 L1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Description: major capsid L1 protein
• Source: E. coli
• Species: Human papillomavirus 31
• Tag: His
• Form: PBS, 0.05%SKL, pH7.4.
• Molecular Mass: 57 kDa
• AA Sequence: MSLWRPSEATVYLPPVPVSKVVSTDEYVTRTNIYYHAGSARLLTVGHPYYSIPKSDNPKKIVVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPETQRLVWACVGLEVGRGQPLGVGISGHPLLNKFDDTENSNRYAGGPGTDNRECISMDYKQTQLCLLGCKPPIGEHWGKGSPCSNNAITPGDCPPLELKNSVIQDGDMVDTGFGAMDFTALQDTKSNVPLDICNSICKYPDYLKMVAEPYGDTLFFYLRREQMFVRHFFNRSGTVGESVPTDLYIKGSGSTATLANSTYFPTPSGSMVTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVDTTRSTNMSVCAAIANSDTTFKSSNFKEYLRHGEEFDLQFIFQLCKITLSADIMTYIHSMNPAILEDWNFGLTTPPSGSLEDTYRFVTSQAITCQKTAPQKPKEDPFKDYVFWEVNLKEKFSADLDQFPLGRKFLLQAGYRARPKFKAGKRSAPSASTTTPAKRKKTKKHHHHHHHH
• Endotoxin: ＜1EU/ug
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.05 mg/ml

Gene Information

• Gene Name: L1 L1 [ Human papillomavirus ]
• Official Symbol: L1
• Synonyms: AMQ97_gp6
• Gene ID: 25479185
• Protein Refseq: YP_009163896
• UniProt ID: P17388