Recombinant Human PAK1 protein, His-SUMO-tagged

Cat.No. : PAK1-4366H
Product Overview : Recombinant Human PAK1 protein(Q13153)(1-545aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&SUMO
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 76.6 kDa
Protein length : 1-545aa
AA Sequence : MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 [ Homo sapiens ]
Official Symbol PAK1
Synonyms PAK1; p21 protein (Cdc42/Rac)-activated kinase 1; p21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast) , p21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); serine/threonine-protein kinase PAK 1; STE20 homolog; yeast; p65-PAK; alpha-PAK; STE20 homolog, yeast; p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related); p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast); PAKalpha; MGC130000; MGC130001;
Gene ID 5058
mRNA Refseq NM_001128620
Protein Refseq NP_001122092
MIM 602590
UniProt ID Q13153

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PAK1 Products

Required fields are marked with *

My Review for All PAK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon