Recombinant Human P2RX3
Cat.No. : | P2RX3-30538TH |
Product Overview : | Recombinant fragment corresponding to amino acids 45-154 of Human P2X3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPP QGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGP ERLPGGGILTGRCVNYSSVLRTCEIQGWCP |
Sequence Similarities : | Belongs to the P2X receptor family. |
Gene Name | P2RX3 purinergic receptor P2X, ligand-gated ion channel, 3 [ Homo sapiens ] |
Official Symbol | P2RX3 |
Synonyms | P2RX3; purinergic receptor P2X, ligand-gated ion channel, 3; P2X purinoceptor 3; P2X3; |
Gene ID | 5024 |
mRNA Refseq | NM_002559 |
Protein Refseq | NP_002550 |
MIM | 600843 |
Uniprot ID | P56373 |
Chromosome Location | 11q12 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; |
Function | ATP binding; extracellular ATP-gated cation channel activity; extracellular ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity; |
◆ Recombinant Proteins | ||
P2RX3-1492H | Recombinant Human P2RX3 protein, His-tagged | +Inquiry |
P2RX3-6456M | Recombinant Mouse P2RX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
P2RX3-12267M | Recombinant Mouse P2RX3 Protein | +Inquiry |
P2RX3-9164H | Recombinant Human P2RX3, MYC/DDK-tagged | +Inquiry |
P2rx3-4636M | Recombinant Mouse P2rx3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX3-3500HCL | Recombinant Human P2RX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P2RX3 Products
Required fields are marked with *
My Review for All P2RX3 Products
Required fields are marked with *
0
Inquiry Basket