Recombinant Human OxT protein, His&Myc-tagged

• Cat.No.: OxT-3313H
• Product Overview: Recombinant Human OxT protein(P01178)(32-125aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 32-125aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.6 kDa
• AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: OXT oxytocin, prepropeptide [ Homo sapiens ]
• Official Symbol: OxT
• Synonyms: OXT; oxytocin, prepropeptide; OT, oxytocin, prepro (neurophysin I); oxytocin-neurophysin 1; neurophysin I; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein; OT; OT-NPI; MGC126890; MGC126892
• Gene ID: 5020
• mRNA Refseq: NM_000915
• Protein Refseq: NP_000906
• MIM: 167050
• UniProt ID: P01178